SCOPe 2.07: Domain d2k7ja1: 2k7j A:2-99

Lineage for d2k7ja1 (2k7j A:2-99)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
   automatically mapped to Pfam PF00708

6. Protein automated matches [191024] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188822] (6 PDB entries)

8. Domain d2k7ja1: 2k7j A:2-99 [242399]
   Other proteins in same PDB: d2k7ja2
   automated match to d2acya_

Details for d2k7ja1

PDB Entry: 2k7j

PDB Description: human acylphosphatase(acph) surface charge-optimized

PDB Compounds: (A:) acylphosphatase-1

SCOPe Domain Sequences for d2k7ja1:

Sequence; same for both SEQRES and ATOM records:

>d2k7ja1 d.58.10.1 (A:2-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgklqgpiskvre
mqkwletrgspeshidkanfknekvilkldysdfqivk

Timeline for d2k7ja1:

• d2k7ja1 first appeared in SCOPe 2.04, called d2k7ja_
  
• d2k7ja1 appears in SCOPe 2.06
  
• d2k7ja1 appears in the current release, SCOPe 2.08