SCOPe 2.06: Domain d2k7ha_: 2k7h A:

Lineage for d2k7ha_ (2k7h A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein automated matches [190058] (6 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [255325] (1 PDB entry)

8. Domain d2k7ha_: 2k7h A: [242398]
   automated match to d2qima_

Details for d2k7ha_

PDB Entry: 2k7h

PDB Description: nmr solution structure of soybean allergen gly m 4

PDB Compounds: (A:) Stress-induced protein SAM22

SCOPe Domain Sequences for d2k7ha_:

Sequence; same for both SEQRES and ATOM records:

>d2k7ha_ d.129.3.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gvftfedeinspvapatlykalvtdadnvipkaldsfksvenvegnggpgtikkitfled
getkfvlhkiesideanlgysysvvggaalpdtaekitfdsklvagpnggsagkltvkye
tkgdaepnqdelktgkakadalfkaieayllahpdyn

Timeline for d2k7ha_:

• d2k7ha_ first appeared in SCOPe 2.04
  
• d2k7ha_ appears in SCOPe 2.05
  
• d2k7ha_ appears in SCOPe 2.07
  
• d2k7ha_ appears in the current release, SCOPe 2.08