Lineage for d2k4ua_ (2k4u A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1960727Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1960843Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 1960968Protein automated matches [197331] (4 species)
    not a true protein
  7. 1960973Species Mesobuthus martensii [TaxId:34649] [255319] (3 PDB entries)
  8. 1960976Domain d2k4ua_: 2k4u A: [242378]
    automated match to d1bkta_

Details for d2k4ua_

PDB Entry: 2k4u (more details)

PDB Description: solution structure of the scorpion toxin adwx-1
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 3.6

SCOPe Domain Sequences for d2k4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k4ua_ g.3.7.2 (A:) automated matches {Mesobuthus martensii [TaxId: 34649]}
vginvkckhsrqclkpckdagmrfgkctngkchctpk

SCOPe Domain Coordinates for d2k4ua_:

Click to download the PDB-style file with coordinates for d2k4ua_.
(The format of our PDB-style files is described here.)

Timeline for d2k4ua_: