PDB entry 2k4u

View 2k4u on RCSB PDB site
Description: Solution structure of the SCORPION TOXIN ADWX-1
Class: toxin
Keywords: KV1.1 CHANNEL, KV1.3 CHANNEL, CHANNEL TURRET, ADWX-1 PEPTIDE SELECTIVITY, STRUCTURAL BASIS, Amidation, Ionic channel inhibitor, Neurotoxin, Potassium channel inhibitor, Secreted, Toxin
Deposited on 2008-06-18, released 2008-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 3.6
    Species: Mesobuthus martensii [TaxId:34649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NII7 (0-36)
      • engineered (10)
      • engineered (27)
      • engineered (32)
    Domains in SCOPe 2.05: d2k4ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2k4uA (A:)
    vginvkckhsrqclkpckdagmrfgkctngkchctpk