Lineage for d2k1da_ (2k1d A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890617Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1890618Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1890619Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1890683Protein automated matches [191016] (9 species)
    not a true protein
  7. 1890692Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)
  8. 1890702Domain d2k1da_: 2k1d A: [242343]
    automated match to d1fo7a_
    mutant

Details for d2k1da_

PDB Entry: 2k1d (more details)

PDB Description: nmr studies of a pathogenic mutant (d178n) of the human prion protein
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2k1da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1da_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvniti
kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgss

SCOPe Domain Coordinates for d2k1da_:

Click to download the PDB-style file with coordinates for d2k1da_.
(The format of our PDB-style files is described here.)

Timeline for d2k1da_: