Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries) |
Domain d2k1da_: 2k1d A: [242343] automated match to d1fo7a_ mutant |
PDB Entry: 2k1d (more details)
SCOPe Domain Sequences for d2k1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k1da_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvniti kqhtvttttkgenftetdvkmmervveqmcitqyeresqayyqrgss
Timeline for d2k1da_: