Lineage for d2k1ba_ (2k1b A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537732Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1537890Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 1537891Protein automated matches [191139] (3 species)
    not a true protein
  7. 1537901Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)
  8. 1537921Domain d2k1ba_: 2k1b A: [242342]
    automated match to d3tzda_

Details for d2k1ba_

PDB Entry: 2k1b (more details)

PDB Description: solution nmr structure of the chromo domain of the chromobox protein homolog 7
PDB Compounds: (A:) Chromobox protein homolog 7

SCOPe Domain Sequences for d2k1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k1ba_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqvfavesirkkrvrkgkveylvkwkgwppkystwepeehildprlvmayeekee

SCOPe Domain Coordinates for d2k1ba_:

Click to download the PDB-style file with coordinates for d2k1ba_.
(The format of our PDB-style files is described here.)

Timeline for d2k1ba_: