Lineage for d2jzma_ (2jzm A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038566Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 3038567Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 3038568Family g.69.1.1: Plant proteinase inhibitors [57486] (4 proteins)
  6. 3038591Protein automated matches [254462] (2 species)
    not a true protein
  7. 3038594Species Winged tobacco (Nicotiana alata) [TaxId:4087] [254990] (3 PDB entries)
  8. 3038597Domain d2jzma_: 2jzm A: [242319]
    automated match to d1tiha_

Details for d2jzma_

PDB Entry: 2jzm (more details)

PDB Description: chymotrypsin inhibitor c1 from nicotiana alata
PDB Compounds: (A:) proteinase inhibitor

SCOPe Domain Sequences for d2jzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jzma_ g.69.1.1 (A:) automated matches {Winged tobacco (Nicotiana alata) [TaxId: 4087]}
drictnccagtkgckyfsddgtfvcegesdprnpkactlncdpriaygvcprs

SCOPe Domain Coordinates for d2jzma_:

Click to download the PDB-style file with coordinates for d2jzma_.
(The format of our PDB-style files is described here.)

Timeline for d2jzma_: