Lineage for d1c4rc_ (1c4r C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460344Family b.29.1.4: Laminin G-like module [49944] (5 proteins)
  6. 460370Protein Ligand-binding domain of neurexin 1beta [49949] (1 species)
  7. 460371Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (1 PDB entry)
  8. 460374Domain d1c4rc_: 1c4r C: [24231]

Details for d1c4rc_

PDB Entry: 1c4r (more details), 2.6 Å

PDB Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing

SCOP Domain Sequences for d1c4rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4rc_ b.29.1.4 (C:) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus)}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev

SCOP Domain Coordinates for d1c4rc_:

Click to download the PDB-style file with coordinates for d1c4rc_.
(The format of our PDB-style files is described here.)

Timeline for d1c4rc_: