Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein Ligand-binding domain of neurexin 1beta [49949] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries) |
Domain d1c4rc_: 1c4r C: [24231] |
PDB Entry: 1c4r (more details), 2.6 Å
SCOPe Domain Sequences for d1c4rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4rc_ b.29.1.4 (C:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]} hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev
Timeline for d1c4rc_: