Class g: Small proteins [56992] (100 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.0: automated matches [254208] (1 protein) not a true family |
Protein automated matches [254463] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255304] (3 PDB entries) |
Domain d2jxda_: 2jxd A: [242299] automated match to d1tgsi_ |
PDB Entry: 2jxd (more details)
SCOPe Domain Sequences for d2jxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jxda_ g.68.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pqfglfskyrtpncsqyrlpgcprhfnpvcgsdmstyanectlcmkiregghnikiirng pc
Timeline for d2jxda_: