Lineage for d2jxda_ (2jxd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038555Family g.68.1.0: automated matches [254208] (1 protein)
    not a true family
  6. 3038556Protein automated matches [254463] (3 species)
    not a true protein
  7. 3038559Species Human (Homo sapiens) [TaxId:9606] [255304] (3 PDB entries)
  8. 3038562Domain d2jxda_: 2jxd A: [242299]
    automated match to d1tgsi_

Details for d2jxda_

PDB Entry: 2jxd (more details)

PDB Description: nmr structure of human serine protease inhibitor kazal type ii (spink2)
PDB Compounds: (A:) Serine protease inhibitor Kazal-type 2

SCOPe Domain Sequences for d2jxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxda_ g.68.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqfglfskyrtpncsqyrlpgcprhfnpvcgsdmstyanectlcmkiregghnikiirng
pc

SCOPe Domain Coordinates for d2jxda_:

Click to download the PDB-style file with coordinates for d2jxda_.
(The format of our PDB-style files is described here.)

Timeline for d2jxda_: