SCOPe 2.04: Domain d2jvva_: 2jvv A:

Lineage for d2jvva_ (2jvv A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)

6. Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)

7. Species Escherichia coli [TaxId:562] [255301] (1 PDB entry)

8. Domain d2jvva_: 2jvv A: [242296]
   automated match to d1nz9a_

Details for d2jvva_

PDB Entry: 2jvv

PDB Description: Solution Structure of E. coli NusG carboxyterminal domain

PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d2jvva_:

Sequence; same for both SEQRES and ATOM records:

>d2jvva_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Escherichia coli [TaxId: 562]}
rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka

Timeline for d2jvva_:

• d2jvva_ is new in SCOPe 2.04-stable
  
• d2jvva_ appears in SCOPe 2.05
  
• d2jvva_ appears in the current release, SCOPe 2.08