Lineage for d2jvia1 (2jvi A:1-124)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114938Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2114939Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2114955Domain d2jvia1: 2jvi A:1-124 [242293]
    Other proteins in same PDB: d2jvia2
    automated match to d2fspa_
    mutant

Details for d2jvia1

PDB Entry: 2jvi (more details)

PDB Description: nmr solution structure of the hyper-sporulation response regulator spo0f mutant h101a from bacillus subtilis
PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2jvia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jvia1 c.23.1.1 (A:1-124) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgaltafakpfdideirdavkkylp
lksn

SCOPe Domain Coordinates for d2jvia1:

Click to download the PDB-style file with coordinates for d2jvia1.
(The format of our PDB-style files is described here.)

Timeline for d2jvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jvia2