SCOPe 2.05: Domain d2joha_: 2joh A:

Lineage for d2joha_ (2joh A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)

8. Domain d2joha_: 2joh A: [242254]
   automated match to d4hmmb_
   mutant

Details for d2joha_

PDB Entry: 2joh

PDB Description: nmr structure of rabbit prion protein mutation s173n

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2joha_:

Sequence; same for both SEQRES and ATOM records:

>d2joha_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitv
kqhtvttttkgenftetdikimervveqmcitqyqqesqaayqra

Timeline for d2joha_:

• d2joha_ first appeared in SCOPe 2.04
  
• d2joha_ appears in SCOPe 2.06
  
• d2joha_ appears in the current release, SCOPe 2.08