Lineage for d2joha_ (2joh A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 protein domains)
  6. 2499063Protein automated matches [191016] (9 species)
    not a true protein
  7. 2499100Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)
  8. 2499109Domain d2joha_: 2joh A: [242254]
    automated match to d4hmmb_
    mutant

Details for d2joha_

PDB Entry: 2joh (more details)

PDB Description: NMR structure of rabbit prion protein mutation S173N
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2joha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joha_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnitv
kqhtvttttkgenftetdikimervveqmcitqyqqesqaayqra

SCOPe Domain Coordinates for d2joha_:

Click to download the PDB-style file with coordinates for d2joha_.
(The format of our PDB-style files is described here.)

Timeline for d2joha_: