SCOPe 2.06: Domain d2jnjb1: 2jnj B:4-74

Lineage for d2jnjb1 (2jnj B:4-74)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.295: TFB5-like [142896] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers, a/b; antiparallel sheet, order: 132; dimerises in solution (PDB 2jnj) via extended N-terminal strand

4. Superfamily d.295.1: TFB5-like [142897] (2 families)

5. Family d.295.1.1: TFB5-like [142898] (2 proteins)
   Pfam PF06331

6. Protein automated matches [254556] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255278] (1 PDB entry)

8. Domain d2jnjb1: 2jnj B:4-74 [242247]
   Other proteins in same PDB: d2jnja2, d2jnjb2
   automated match to d1ydla1

Details for d2jnjb1

PDB Entry: 2jnj

PDB Description: solution structure of the p8 tfiih subunit

PDB Compounds: (B:) TFIIH basal transcription factor complex TTD-A subunit

SCOPe Domain Sequences for d2jnjb1:

Sequence; same for both SEQRES and ATOM records:

>d2jnjb1 d.295.1.1 (B:4-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvnvlkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgel
mdqnafsltqk

Timeline for d2jnjb1:

• d2jnjb1 first appeared in SCOPe 2.04, called d2jnjb_
  
• d2jnjb1 was called d2jnjb_ in SCOPe 2.05
  
• d2jnjb1 appears in SCOPe 2.07
  
• d2jnjb1 appears in the current release, SCOPe 2.08