Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein automated matches [190627] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187902] (3 PDB entries) |
Domain d2ja3f1: 2ja3 F:578-746 [242206] Other proteins in same PDB: d2ja3a2, d2ja3b2, d2ja3c2, d2ja3d2, d2ja3e2, d2ja3f2 automated match to d2j9lc_ complexed with adp |
PDB Entry: 2ja3 (more details), 3.05 Å
SCOPe Domain Sequences for d2ja3f1:
Sequence, based on SEQRES records: (download)
>d2ja3f1 d.37.1.1 (F:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]} hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr rdliisienarkkqdgvvstsiiyftehspplppytpptlklrnildlspftvtdltpme ivvdifrklglrqclvthngrllgiitkkdvlkhiaqmanqdpdsilfn
>d2ja3f1 d.37.1.1 (F:578-746) automated matches {Human (Homo sapiens) [TaxId: 9606]} hktlamdvmkprrndplltvltqdsmtvedvetiisettysgfpvvvsresqrlvgfvlr rdliisienarkgvvstsiiyftehspplppytpptlklrnildlspftvtdltpmeivv difrklglrqclvthngrllgiitkkdvlkhiaqmilfn
Timeline for d2ja3f1: