Lineage for d1c1fa_ (1c1f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779198Protein Congerin I [49942] (1 species)
  7. 2779199Species Conger eel (Conger myriaster) [TaxId:7943] [49943] (2 PDB entries)
  8. 2779201Domain d1c1fa_: 1c1f A: [24220]

Details for d1c1fa_

PDB Entry: 1c1f (more details), 1.6 Å

PDB Description: ligand-free congerin i
PDB Compounds: (A:) protein (congerin I)

SCOPe Domain Sequences for d1c1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1fa_ b.29.1.3 (A:) Congerin I {Conger eel (Conger myriaster) [TaxId: 7943]}
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle

SCOPe Domain Coordinates for d1c1fa_:

Click to download the PDB-style file with coordinates for d1c1fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c1fa_: