PDB entry 1c1f

View 1c1f on RCSB PDB site
Description: ligand-free congerin I
Class: sugar binding protein
Keywords: galectin, lectin, beta-galactose-binding, sugar binding protein
Deposited on 1999-03-03, released 1999-10-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (congerin I)
    Species: Conger myriaster [TaxId:7943]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26788 (Start-135)
      • insertion (134)
    Domains in SCOPe 2.07: d1c1fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1fA (A:)
    sgglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivm
    nstlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflp
    flslagdarltlvkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1fA (A:)
    gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
    stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
    lslagdarltlvkle