SCOPe 2.07: Domain d1a78a_: 1a78 A:

Lineage for d1a78a_ (1a78 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Toad (Bufo arenarum) [TaxId:38577] [49937] (2 PDB entries)

8. Domain d1a78a_: 1a78 A: [24212]
   complexed with dtt, tdg

Details for d1a78a_

PDB Entry: 1a78, 2 Å

PDB Description: complex of toad ovary galectin with thio-digalactose

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d1a78a_:

Sequence; same for both SEQRES and ATOM records:

>d1a78a_ b.29.1.3 (A:) Galectin-1 {Toad (Bufo arenarum) [TaxId: 38577]}
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqreevfpfqqgaevmvcfeyqtqkiiikfssgdqfsfpvrkvlpsipf
lsleglafksitte

Timeline for d1a78a_:

• d1a78a_ first appeared (with stable ids) in SCOP 1.55
  
• d1a78a_ appears in SCOPe 2.06
  
• d1a78a_ appears in the current release, SCOPe 2.08