SCOPe 2.08: Domain d1qmja_: 1qmj A:

Lineage for d1qmja_ (1qmj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49936] (1 PDB entry)
   galectin-1 homologue CG-16

8. Domain d1qmja_: 1qmj A: [24210]
   complexed with bme

Details for d1qmja_

PDB Entry: 1qmj, 2.15 Å

PDB Description: cg-16, a homodimeric agglutinin from chicken liver

PDB Compounds: (A:) beta-galactoside-binding lectin

SCOPe Domain Sequences for d1qmja_:

Sequence; same for both SEQRES and ATOM records:

>d1qmja_ b.29.1.3 (A:) Galectin-1 {Chicken (Gallus gallus) [TaxId: 9031]}
qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
egdfkvkaikfs

Timeline for d1qmja_:

• d1qmja_ first appeared (with stable ids) in SCOP 1.55
  
• d1qmja_ appears in SCOPe 2.07