Lineage for d1qmja_ (1qmj A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) 
Protein S-lectin, different isoforms [49933] (4 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [49936] (1 PDB entry) 
Domain d1qmja_: 1qmj A: [24210]
Details for d1qmja_
PDB Entry: 1qmj (more details), 2.15 Å
PDB Description: cg-16, a homodimeric agglutinin from chicken liver
SCOP Domain Sequences for d1qmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmja_ b.29.1.3 (A:) S-lectin, different isoforms {Chicken (Gallus gallus)}
qglvvtqldvqpgecvkvkgkilsdakgfsvnvgkdsstlmlhfnprfdchgdvntvvcn
skedgtwgeedrkadfpfqqgdkveicisfdaaevkvkvpevefefpnrlgmekiqylav
egdfkvkaikfs
SCOP Domain Coordinates for d1qmja_:
Click to download the PDB-style file with coordinates for d1qmja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qmja_:
- d1qmja_ appears in SCOP 1.57
- d1qmja_ appears in the current release, SCOPe 2.08
View in 3D
