Lineage for d2i96a_ (2i96 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212846Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2212847Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2212848Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2212918Protein automated matches [190702] (5 species)
    not a true protein
  7. 2212932Species Human (Homo sapiens) [TaxId:9606] [189965] (2 PDB entries)
  8. 2212935Domain d2i96a_: 2i96 A: [242097]
    automated match to d1hkoa_
    complexed with hem

Details for d2i96a_

PDB Entry: 2i96 (more details)

PDB Description: solution structure of the oxidized microsomal human cytochrome b5
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d2i96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i96a_ d.120.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeqsdeavkyytleeiqkhnhskstwlilhhkvydltkfleehpggeevlreqaggdat
enfedvghstdaremsktfiigelhpddrpklnkppetlittidssss

SCOPe Domain Coordinates for d2i96a_:

Click to download the PDB-style file with coordinates for d2i96a_.
(The format of our PDB-style files is described here.)

Timeline for d2i96a_: