SCOPe 2.08: Domain d1hlcb_: 1hlc B:

Lineage for d1hlcb_ (1hlc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein S-lac lectin, L-14-II [100927] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100928] (1 PDB entry)

8. Domain d1hlcb_: 1hlc B: [24209]

Details for d1hlcb_

PDB Entry: 1hlc, 2.9 Å

PDB Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-ii, in complex with lactose at 2.9 angstroms resolution

PDB Compounds: (B:) human lectin

SCOPe Domain Sequences for d1hlcb_:

Sequence; same for both SEQRES and ATOM records:

>d1hlcb_ b.29.1.3 (B:) S-lac lectin, L-14-II {Human (Homo sapiens) [TaxId: 9606]}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklke

Timeline for d1hlcb_:

• d1hlcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hlcb_ appears in SCOPe 2.07