PDB entry 1hlc

View 1hlc on RCSB PDB site
Description: x-ray crystal structure of the human dimeric s-lac lectin, l-14-II, in complex with lactose at 2.9 angstroms resolution
Class: lectin
Keywords: lectin
Deposited on 1993-10-13, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human lectin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hlca_
  • Chain 'B':
    Compound: human lectin
    Species: Homo sapiens [TaxId:9606]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hlcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlcA (A:)
    elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
    nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
    nmssfklke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlcB (B:)
    elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
    nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
    nmssfklke