SCOPe 2.04: Domain d2hr7a1: 2hr7 A:4-156

Lineage for d2hr7a1 (2hr7 A:4-156)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries)

8. Domain d2hr7a1: 2hr7 A:4-156 [242060]
   Other proteins in same PDB: d2hr7a2, d2hr7b2
   automated match to d2dtge4
   complexed with gol, nag, p33, so4

Details for d2hr7a1

PDB Entry: 2hr7, 2.32 Å

PDB Description: insulin receptor (domains 1-3)

PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d2hr7a1:

Sequence; same for both SEQRES and ATOM records:

>d2hr7a1 c.10.2.0 (A:4-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylll
frvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknn
elcylatidwsrildsvednhivlnkddneecg

Timeline for d2hr7a1:

• d2hr7a1 is new in SCOPe 2.04-stable
  
• d2hr7a1 appears in SCOPe 2.05
  
• d2hr7a1 appears in the current release, SCOPe 2.07