Class g: Small proteins [56992] (91 folds) |
Fold g.9: Defensin-like [57391] (1 superfamily) Disulfide-rich fold, nearly all-beta |
Superfamily g.9.1: Defensin-like [57392] (3 families) |
Family g.9.1.1: Defensin [57393] (11 proteins) |
Protein automated matches [190738] (3 species) not a true protein |
Species Condylactis gigantea [TaxId:47073] [255204] (1 PDB entry) |
Domain d2h9xa_: 2h9x A: [242021] automated match to d1ahla_ |
PDB Entry: 2h9x (more details)
SCOPe Domain Sequences for d2h9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9xa_ g.9.1.1 (A:) automated matches {Condylactis gigantea [TaxId: 47073]} gvpcrcdsdgpsvhgntlsgtvwvgscasgwhkcndeyniayecckq
Timeline for d2h9xa_: