Lineage for d2h9xa_ (2h9x A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702803Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 1702804Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 1702805Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 1702886Protein automated matches [190738] (3 species)
    not a true protein
  7. 1702887Species Condylactis gigantea [TaxId:47073] [255204] (1 PDB entry)
  8. 1702888Domain d2h9xa_: 2h9x A: [242021]
    automated match to d1ahla_

Details for d2h9xa_

PDB Entry: 2h9x (more details)

PDB Description: nmr structure for the cgna toxin from the sea anemone condylactis gigantea
PDB Compounds: (A:) Toxin CgNa

SCOPe Domain Sequences for d2h9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9xa_ g.9.1.1 (A:) automated matches {Condylactis gigantea [TaxId: 47073]}
gvpcrcdsdgpsvhgntlsgtvwvgscasgwhkcndeyniayecckq

SCOPe Domain Coordinates for d2h9xa_:

Click to download the PDB-style file with coordinates for d2h9xa_.
(The format of our PDB-style files is described here.)

Timeline for d2h9xa_: