Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.6: Holliday junction resolvase RusA [103084] (1 family) automatically mapped to Pfam PF05866 |
Family d.79.6.1: Holliday junction resolvase RusA [103085] (2 proteins) |
Protein automated matches [190678] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [187792] (2 PDB entries) |
Domain d2h8cd_: 2h8c D: [242020] automated match to d2h8ea_ protein/DNA complex |
PDB Entry: 2h8c (more details), 3.1 Å
SCOPe Domain Sequences for d2h8cd_:
Sequence, based on SEQRES records: (download)
>d2h8cd_ d.79.6.1 (D:) automated matches {Escherichia coli [TaxId: 562]} ntysitlpwppsnnryyrhnrgrthvsaegqayrdnvariiknamldiglampvkiriec hmpdrrrrnldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg
>d2h8cd_ d.79.6.1 (D:) automated matches {Escherichia coli [TaxId: 562]} ntysitlpwppsnnryyrthvsaegqayrdnvariiknamldiglampvkiriechmpdr rrrnldnlqkaafdaltkagfwlddaqvvdyrvvkmpvtkggrleltitemg
Timeline for d2h8cd_: