| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein automated matches [190329] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries) |
| Domain d2h2rb_: 2h2r B: [241996] automated match to d1t8ca1 |
PDB Entry: 2h2r (more details), 1.5 Å
SCOPe Domain Sequences for d2h2rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2rb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkrasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqsedcvmmrgsgrwndafcdrkl
gawvcdrlatctpp
Timeline for d2h2rb_: