Lineage for d2h2rb_ (2h2r B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607761Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)
  8. 2607768Domain d2h2rb_: 2h2r B: [241996]
    automated match to d1t8ca1

Details for d2h2rb_

PDB Entry: 2h2r (more details), 1.5 Å

PDB Description: crystal structure of the human cd23 lectin domain, apo form
PDB Compounds: (B:) Low affinity immunoglobulin epsilon Fc receptor (Lymphocyte IgE receptor) (Fc-epsilon-RII)(Immunoglobulin E-binding factor) (CD23 antigen)

SCOPe Domain Sequences for d2h2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2rb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkrasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqsedcvmmrgsgrwndafcdrkl
gawvcdrlatctpp

SCOPe Domain Coordinates for d2h2rb_:

Click to download the PDB-style file with coordinates for d2h2rb_.
(The format of our PDB-style files is described here.)

Timeline for d2h2rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2h2ra_