Lineage for d2gsba1 (2gsb A:8-113)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2531015Domain d2gsba1: 2gsb A:8-113 [241974]
    Other proteins in same PDB: d2gsba2, d2gsba3
    automated match to d3n84b_

Details for d2gsba1

PDB Entry: 2gsb (more details)

PDB Description: Solution structure of the second SH2 domain of human Ras GTPase-activating protein 1
PDB Compounds: (A:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d2gsba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsba1 d.93.1.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
reedphegkiwfhgkiskqeaynllmtvgqvcsflvrpsdntpgdyslyfrtneniqrfk
icptpnnqfmmggryynsigdiidhyrkeqivegyylkepvpmqdq

SCOPe Domain Coordinates for d2gsba1:

Click to download the PDB-style file with coordinates for d2gsba1.
(The format of our PDB-style files is described here.)

Timeline for d2gsba1: