Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (18 PDB entries) |
Domain d2gerc2: 2ger C:165-275 [241926] Other proteins in same PDB: d2gera1, d2gera3, d2gerb1, d2gerb3, d2gerc1, d2gerc3, d2gerd1, d2gerd3, d2gere1, d2gere3 automated match to d2izzb2 |
PDB Entry: 2ger (more details), 3.1 Å
SCOPe Domain Sequences for d2gerc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gerc2 a.100.1.0 (C:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe
Timeline for d2gerc2: