SCOPe 2.08: Domain d1slta_: 1slt A:

Lineage for d1slta_ (1slt A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)

8. Domain d1slta_: 1slt A: [24186]
   complexed with cl

Details for d1slta_

PDB Entry: 1slt, 1.9 Å

PDB Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein

PDB Compounds: (A:) bovine galectin-1

SCOPe Domain Sequences for d1slta_:

Sequence; same for both SEQRES and ATOM records:

>d1slta_ b.29.1.3 (A:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
aggdfkikcvafe

Timeline for d1slta_:

• d1slta_ first appeared (with stable ids) in SCOP 1.55
  
• d1slta_ appears in SCOPe 2.07