Lineage for d2fhyh_ (2fhy H:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015828Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 3015829Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 3015830Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 3016081Protein automated matches [190281] (5 species)
    not a true protein
  7. 3016085Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. 3016322Domain d2fhyh_: 2fhy H: [241854]
    automated match to d1fsaa_
    complexed with a37, mg

Details for d2fhyh_

PDB Entry: 2fhy (more details), 2.95 Å

PDB Description: structure of human liver fpbase complexed with a novel benzoxazole as allosteric inhibitor
PDB Compounds: (H:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d2fhyh_:

Sequence, based on SEQRES records: (download)

>d2fhyh_ e.7.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

Sequence, based on observed residues (ATOM records): (download)

>d2fhyh_ e.7.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagskldvls
ndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidclvsvgtifg
iyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldpaigefilvd
kdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsmvadvhrtlv
yggiflypankkspngklrllyecnpmayvmekaggmattgkeavldviptdihqrapvi
lgspddvleflkvyekhs

SCOPe Domain Coordinates for d2fhyh_:

Click to download the PDB-style file with coordinates for d2fhyh_.
(The format of our PDB-style files is described here.)

Timeline for d2fhyh_: