SCOPe 2.06: Domain d2fewb_: 2few B:

Lineage for d2fewb_ (2few B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.2: PTS system IIB component-like [52794] (3 families)

5. Family c.44.2.1: PTS system, Lactose/Cellobiose specific IIB subunit [52795] (3 proteins)
   Pfam PF02302

6. Protein automated matches [254437] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [254923] (2 PDB entries)

8. Domain d2fewb_: 2few B: [241835]
   Other proteins in same PDB: d2fewa_
   automated match to d1vkra_

Details for d2fewb_

PDB Entry: 2few

PDB Description: complex of enzyme iiamtl and phosphorylated enzyme iibmtl from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (B:) mannitol-specific PTS system enzyme IIABC components

SCOPe Domain Sequences for d2fewb_:

Sequence; same for both SEQRES and ATOM records:

>d2fewb_ c.44.2.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
eramrqvpqaqhisltnfldsglytslterlvaaqrh

Timeline for d2fewb_:

• d2fewb_ first appeared in SCOPe 2.04
  
• d2fewb_ appears in SCOPe 2.05
  
• d2fewb_ appears in SCOPe 2.07
  
• d2fewb_ appears in the current release, SCOPe 2.08