|  | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) | 
|  | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing | 
|  | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)  | 
|  | Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 | 
|  | Protein Phosphotransferase IIa-mannitol [55808] (1 species) | 
|  | Species Escherichia coli [TaxId:562] [55809] (3 PDB entries) | 
|  | Domain d2fewa_: 2few A: [241834] Other proteins in same PDB: d2fewb_ automated match to d1a3ac_ | 
PDB Entry: 2few (more details)
SCOPe Domain Sequences for d2fewa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fewa_ d.112.1.1 (A:) Phosphotransferase IIa-mannitol {Escherichia coli [TaxId: 562]}
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
pqgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr
Timeline for d2fewa_: