Lineage for d2fewa_ (2few A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666093Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 1666094Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 1666095Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 1666100Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 1666101Species Escherichia coli [TaxId:562] [55809] (3 PDB entries)
  8. 1666106Domain d2fewa_: 2few A: [241834]
    Other proteins in same PDB: d2fewb_
    automated match to d1a3ac_

Details for d2fewa_

PDB Entry: 2few (more details)

PDB Description: complex of enzyme iiamtl and phosphorylated enzyme iibmtl from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) PTS system mannitol-specific EIICBA component

SCOPe Domain Sequences for d2fewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fewa_ d.112.1.1 (A:) Phosphotransferase IIa-mannitol {Escherichia coli [TaxId: 562]}
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
pqgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr

SCOPe Domain Coordinates for d2fewa_:

Click to download the PDB-style file with coordinates for d2fewa_.
(The format of our PDB-style files is described here.)

Timeline for d2fewa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fewb_