Lineage for d1axkb1 (1axk B:1-156,B:342-394)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944395Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 944396Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 944399Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 944403Domain d1axkb1: 1axk B:1-156,B:342-394 [24182]
    Other proteins in same PDB: d1axka2, d1axkb2
    interrupted by the insertion of a xylanase domain from Bacillus subtilis
    complexed with ca

Details for d1axkb1

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1
PDB Compounds: (B:) gluxyn-1

SCOPe Domain Sequences for d1axkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axkb1 b.29.1.2 (B:1-156,B:342-394) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys
nggvfnctwrannvnftndgklklgltssa

SCOPe Domain Coordinates for d1axkb1:

Click to download the PDB-style file with coordinates for d1axkb1.
(The format of our PDB-style files is described here.)

Timeline for d1axkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axkb2