Lineage for d1axkb1 (1axk B:1-156,B:342-394)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108803Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 108804Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)
  7. 108807Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 108817Domain d1axkb1: 1axk B:1-156,B:342-394 [24182]
    Other proteins in same PDB: d1axka2, d1axkb2

Details for d1axkb1

PDB Entry: 1axk (more details), 2.1 Å

PDB Description: engineered bacillus bifunctional enzyme gluxyn-1

SCOP Domain Sequences for d1axkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axkb1 b.29.1.2 (B:1-156,B:342-394) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsnXgsvfwepksyfnpstwekadgys
nggvfnctwrannvnftndgklklgltssa

SCOP Domain Coordinates for d1axkb1:

Click to download the PDB-style file with coordinates for d1axkb1.
(The format of our PDB-style files is described here.)

Timeline for d1axkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axkb2