Lineage for d1ajoa_ (1ajo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779082Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2779085Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 2779092Domain d1ajoa_: 1ajo A: [24179]
    circularly permuted
    complexed with ca

Details for d1ajoa_

PDB Entry: 1ajo (more details), 2.07 Å

PDB Description: circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-127
PDB Compounds: (A:) circularly permuted (1-3,1-4)-beta-d-glucan 4-glucanohydrolase cpa16m-127

SCOPe Domain Sequences for d1ajoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajoa_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
ghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkimmnlwngtg
vddwlgsynganplyaeydwvkytsnqtggsffepfnsynsgtwekadgysnggvfnctw
rannvnftndgklklgltssaynkfdcaeyrstniygyglyevsmkpakntgivssffty
tgpahgtqwdeidieflgkdttkvqfnyytng

SCOPe Domain Coordinates for d1ajoa_:

Click to download the PDB-style file with coordinates for d1ajoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ajoa_: