Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Pseudomonas sp. [TaxId:69011] [230718] (5 PDB entries) |
Domain d2ei3a2: 2ei3 A:138-302 [241766] automated match to d2ei0a2 complexed with bpy, fe2, gol, mg |
PDB Entry: 2ei3 (more details), 1.9 Å
SCOPe Domain Sequences for d2ei3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ei3a2 d.32.1.0 (A:138-302) automated matches {Pseudomonas sp. [TaxId: 69011]} plhgkfvtgdqglghcivrqtdvaeahkfysllgfrgdveyriplpngmtaelsfmhcna rdhsiafgampaakrlnhlmleythmedlgythqqfvkneidialqlgihandkaltfyg atpsgwliepgwrgataideaeyyvgdifghgveatgygldvkls
Timeline for d2ei3a2: