Lineage for d1cpna_ (1cpn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944395Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 944396Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 944399Species Bacillus macerans [TaxId:44252] [49929] (6 PDB entries)
  8. 944404Domain d1cpna_: 1cpn A: [24175]
    circularly permuted
    complexed with ca

Details for d1cpna_

PDB Entry: 1cpn (more details), 1.8 Å

PDB Description: native-like in vivo folding of a circularly permuted jellyroll protein shown by crystal structure analysis
PDB Compounds: (A:) circularly permuted

SCOPe Domain Sequences for d1cpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpna_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Bacillus macerans [TaxId: 44252]}
fdcaeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkv
qfnyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgk
immnlwngtgvddwlgsynganplyaeydwvkytsngsvfwepksyfnpstwekadgysn
ggvfnctwrannvnftndgklklgltss

SCOPe Domain Coordinates for d1cpna_:

Click to download the PDB-style file with coordinates for d1cpna_.
(The format of our PDB-style files is described here.)

Timeline for d1cpna_: