Lineage for d1byha_ (1byh A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307778Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 1307779Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 1307804Species synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins [49928] (3 PDB entries)
  8. 1307807Domain d1byha_: 1byh A: [24174]
    complexed with ca, nbu

Details for d1byha_

PDB Entry: 1byh (more details), 2.8 Å

PDB Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta- glucanase
PDB Compounds: (A:) hybrid

SCOPe Domain Sequences for d1byha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byha_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOPe Domain Coordinates for d1byha_:

Click to download the PDB-style file with coordinates for d1byha_.
(The format of our PDB-style files is described here.)

Timeline for d1byha_: