![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins) Pfam PF00722 beta-Glucanase-like |
![]() | Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species) |
![]() | Species synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins [49928] (3 PDB entries) |
![]() | Domain d1glha_: 1glh A: [24173] complexed with na |
PDB Entry: 1glh (more details), 2 Å
SCOPe Domain Sequences for d1glha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glha_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins} qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim mnlwngtgvddwlgsynganplyaeydwvkytsn
Timeline for d1glha_: