Lineage for d1glha_ (1glh A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050469Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2050470Protein Bacillus 1-3,1-4-beta-glucanase [49926] (5 species)
  7. 2050496Species synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins [49928] (3 PDB entries)
  8. 2050498Domain d1glha_: 1glh A: [24173]
    complexed with na

Details for d1glha_

PDB Entry: 1glh (more details), 2 Å

PDB Description: cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
PDB Compounds: (A:) 1,3-1,4-beta-glucanase

SCOPe Domain Sequences for d1glha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glha_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {synthetic, hybrid between Bacillus amyloliquefaciens and Bacillus macerans proteins}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

SCOPe Domain Coordinates for d1glha_:

Click to download the PDB-style file with coordinates for d1glha_.
(The format of our PDB-style files is described here.)

Timeline for d1glha_: