SCOP 1.59: Domain d1glh__: 1glh -

Lineage for d1glh__ (1glh -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families)

5. Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)

6. Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species)

7. Species Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans [49928] (3 PDB entries)

8. Domain d1glh__: 1glh - [24173]

Details for d1glh__

PDB Entry: 1glh, 2.2 Å

PDB Description: cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability

SCOP Domain Sequences for d1glh__:

Sequence; same for both SEQRES and ATOM records:

>d1glh__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Hybrid protein: residues 1-16 from Bacillus amyloliquefaciens and Bacillus macerans}
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn

Timeline for d1glh__:

• d1glh__ first appeared (with stable ids) in SCOP 1.55
  
• d1glh__ appears in SCOP 1.57
  
• d1glh__ appears in SCOP 1.61
  
• d1glh__ appears in the current release, SCOPe 2.08, called d1glha_