SCOPe 2.06: Domain d2ebma1: 2ebm A:8-128

Lineage for d2ebma1 (2ebm A:8-128)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (19 PDB entries)

8. Domain d2ebma1: 2ebm A:8-128 [241714]
   Other proteins in same PDB: d2ebma2
   automated match to d2dmfa1

Details for d2ebma1

PDB Entry: 2ebm

PDB Description: solution structure of the rwd domain of human rwd domain containing protein 1

PDB Compounds: (A:) RWD domain-containing protein 1

SCOPe Domain Sequences for d2ebma1:

Sequence; same for both SEQRES and ATOM records:

>d2ebma1 d.20.1.0 (A:8-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtdygeeqrnelealesiypdsftvlsenppsftitvtseagendetvqttlkftyseky
pdeaplyeifsqenledndvsdilkllalqaeenlgmvmiftlvtavqeklneivdqikt
r

Timeline for d2ebma1:

• d2ebma1 first appeared in SCOPe 2.04, called d2ebma_
  
• d2ebma1 was called d2ebma_ in SCOPe 2.05
  
• d2ebma1 appears in SCOPe 2.07
  
• d2ebma1 appears in the current release, SCOPe 2.08