Lineage for d2ebma1 (2ebm A:8-128)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184242Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2184243Protein automated matches [190120] (8 species)
    not a true protein
  7. 2184251Species Human (Homo sapiens) [TaxId:9606] [186843] (19 PDB entries)
  8. 2184280Domain d2ebma1: 2ebm A:8-128 [241714]
    Other proteins in same PDB: d2ebma2
    automated match to d2dmfa1

Details for d2ebma1

PDB Entry: 2ebm (more details)

PDB Description: solution structure of the rwd domain of human rwd domain containing protein 1
PDB Compounds: (A:) RWD domain-containing protein 1

SCOPe Domain Sequences for d2ebma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebma1 d.20.1.0 (A:8-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtdygeeqrnelealesiypdsftvlsenppsftitvtseagendetvqttlkftyseky
pdeaplyeifsqenledndvsdilkllalqaeenlgmvmiftlvtavqeklneivdqikt
r

SCOPe Domain Coordinates for d2ebma1:

Click to download the PDB-style file with coordinates for d2ebma1.
(The format of our PDB-style files is described here.)

Timeline for d2ebma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebma2