Lineage for d1gbg__ (1gbg -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) 
Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins) 
Protein Bacillus 1-3,1-4-beta-glucanase [49926] (3 species) 
Species Bacillus licheniformis [TaxId:1402] [49927] (1 PDB entry) 
Domain d1gbg__: 1gbg - [24171]
Details for d1gbg__
PDB Entry: 1gbg (more details), 1.8 Å
PDB Description: bacillus licheniformis beta-glucanase
SCOP Domain Sequences for d1gbg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbg__ b.29.1.2 (-) Bacillus 1-3,1-4-beta-glucanase {Bacillus licheniformis}
qtggsfyepfnnyntglwqkadgysngnmfnctwrannvsmtslgemrlsltspsynkfd
cgenrsvqtygyglyevnmkpaknvgivssfftytgptdgtpwdeidieflgkdttkvqf
nyytngvgnhekivnlgfdaansyhtyafdwqpnsikwyvdgqlkhtattqipqtpgkim
mnlwngagvdewlgsyngvtplyahynwvrytkr
SCOP Domain Coordinates for d1gbg__:
Click to download the PDB-style file with coordinates for d1gbg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gbg__:
- d1gbg__ first appeared (with stable ids) in SCOP 1.55
- d1gbg__ appears in SCOP 1.57
- d1gbg__ appears in SCOP 1.61
- d1gbg__ appears in the current release, SCOPe 2.08, called d1gbga_
View in 3D