Lineage for d1ioaa_ (1ioa A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2050262Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 2050275Species French bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId:3885] [49922] (1 PDB entry)
  8. 2050276Domain d1ioaa_: 1ioa A: [24168]

Details for d1ioaa_

PDB Entry: 1ioa (more details), 2.7 Å

PDB Description: arcelin-5, a lectin-like defense protein from phaseolus vulgaris
PDB Compounds: (A:) arcelin-5a

SCOPe Domain Sequences for d1ioaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]}
atetsfnfpnfhtddklilqgnatisskgqlqltgvgsnelprvdslgrafysdpiqikd
snnvasfntnftfiiraknqsisayglafalvpvnsppqkkqeflgifntnnpepnartv
avvfntfknridfdknfikpyvnencdfhkyngektdvqitydssnndlrvflhftvsqv
kcsvsatvhlekevdewvsvgfsptsgltedttethdvlswsfsskfr

SCOPe Domain Coordinates for d1ioaa_:

Click to download the PDB-style file with coordinates for d1ioaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ioaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ioab_