Lineage for d2dnea_ (2dne A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1808933Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1809014Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 1809015Protein automated matches [191080] (7 species)
    not a true protein
  7. 1809021Species Human (Homo sapiens) [TaxId:9606] [255119] (2 PDB entries)
  8. 1809022Domain d2dnea_: 2dne A: [241623]
    automated match to d1y8ob_

Details for d2dnea_

PDB Entry: 2dne (more details)

PDB Description: solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
PDB Compounds: (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2dnea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnea_ b.84.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqkvplpslsptmqagtiarwekkegdkinegdliaevetdkatvgfesleecy
makilvaegtrdvpigaiicitvgkpedieafknytldssaasgpssg

SCOPe Domain Coordinates for d2dnea_:

Click to download the PDB-style file with coordinates for d2dnea_.
(The format of our PDB-style files is described here.)

Timeline for d2dnea_: