Lineage for d2dkwa1 (2dkw A:8-125)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2321475Domain d2dkwa1: 2dkw A:8-125 [241585]
    Other proteins in same PDB: d2dkwa2, d2dkwa3
    automated match to d3daia_

Details for d2dkwa1

PDB Entry: 2dkw (more details)

PDB Description: solution structure of the bromodomain of human protein kiaa1240
PDB Compounds: (A:) hypothetical protein KIAA1240

SCOPe Domain Sequences for d2dkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkwa1 a.29.2.0 (A:8-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntlrelrlflrdvtkrlatdkrfnifskpvsdylevikepmdlstvitkidkhnyltakd
flkdidlicsnaleynpdkdpgdkiirhractlkdtahaiiaaeldpefnklceeike

SCOPe Domain Coordinates for d2dkwa1:

Click to download the PDB-style file with coordinates for d2dkwa1.
(The format of our PDB-style files is described here.)

Timeline for d2dkwa1: