SCOPe 2.07: Domain d2dj1a1: 2dj1 A:8-134

Lineage for d2dj1a1 (2dj1 A:8-134)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d2dj1a1: 2dj1 A:8-134 [241573]
   Other proteins in same PDB: d2dj1a2, d2dj1a3
   automated match to d1meka_

Details for d2dj1a1

PDB Entry: 2dj1

PDB Description: the solution structure of the first thioredoxin domain of mouse protein disulfide-isomerase a4

PDB Compounds: (A:) Protein disulfide-isomerase A4

SCOPe Domain Sequences for d2dj1a1:

Sequence; same for both SEQRES and ATOM records:

>d2dj1a1 c.47.1.0 (A:8-134) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dddlevkeengvwvlndgnfdnfvadkdtvllefyapwcghckqfapeyekiastlkdnd
ppiavakidatsasmlaskfdvsgyptikilkkgqavdydgsrtqeeivakvrevsqpdw
tpppevt

Timeline for d2dj1a1:

• d2dj1a1 first appeared in SCOPe 2.04, called d2dj1a_
  
• d2dj1a1 appears in SCOPe 2.06
  
• d2dj1a1 appears in the current release, SCOPe 2.08