SCOPe 2.08: Domain d2dhza1: 2dhz A:8-114

Lineage for d2dhza1 (2dhz A:8-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d2dhza1: 2dhz A:8-114 [241569]
   Other proteins in same PDB: d2dhza2, d2dhza3
   automated match to d1wgya_

Details for d2dhza1

PDB Entry: 2dhz

PDB Description: solution structure of the ra domain in the human link guanine nucleotide exchange factor ii (link-gefii)

PDB Compounds: (A:) Rap guanine nucleotide exchange factor (GEF)-like 1

SCOPe Domain Sequences for d2dhza1:

Sequence; same for both SEQRES and ATOM records:

>d2dhza1 d.15.1.0 (A:8-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deifcrvympdhsyvtirsrlsasvqdilgsvteklqyseepagredslilvavsssgek
vllqptedcvftalginshlfactrdsyealvplpeeiqvspgdtei

Timeline for d2dhza1:

• d2dhza1 first appeared in SCOPe 2.04, called d2dhza_
  
• d2dhza1 appears in SCOPe 2.07